PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D02611.1.p
Common NameEUGRSUZ_D02611, LOC104442369
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 294aa    MW: 32064.1 Da    PI: 9.4857
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D02611.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.51.3e-322882155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      kprlrWt +LHerFv+av++LGG++kAtPk++ +lm++kgLtl+h+kSHLQkYRl
  Eucgr.D02611.1.p 28 KPRLRWTADLHERFVDAVTRLGGPDKATPKSVHRLMGLKGLTLYHLKSHLQKYRL 82
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.5112585IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-312583IPR009057Homeodomain-like
SuperFamilySSF466896.99E-162884IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-232883IPR006447Myb domain, plants
PfamPF002493.6E-83081IPR001005SANT/Myb domain
PfamPF143791.5E-22128174IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MYGGSGSGSG SESGGGGGGG VVMTRDPKPR LRWTADLHER FVDAVTRLGG PDKATPKSVH  60
RLMGLKGLTL YHLKSHLQKY RLGQQMRRQN SDDTTKPSDG FPYVQFSPSR MAGSSSQAGH  120
LQPGGEIPIE ETLKCQIEVQ KRLQEQLEVQ KKLQMRIESQ GKYLQTILEK AQKSLSLDAS  180
GPVNLEATRT QIADFNLAIS NFGDHGRGGG GAVAERNNSS NFINMMMSMK EETYERGGHQ  240
NHGLAFQIYE GERPQAQDIE AKRSEGSSMI HFDLNIKGGH DFLGAKLGSN MMI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D02611.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010054085.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK54e-51APL_ARATH; Myb family transcription factor APL
TrEMBLA0A059CJ510.0A0A059CJ51_EUCGR; Uncharacterized protein
STRINGGLYMA01G01300.19e-92(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM124952530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.15e-61G2-like family protein